"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8RBJ7"	"{'domain_architectures': 7121, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pfam': 1, 'cdd': 1, 'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 7121}"	"['The lipid II isoglutaminyl synthase complex catalyzes the formation of alpha-D-isoglutamine in the cell wall lipid II stem peptide. The GatD subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia. The resulting ammonia molecule is channeled to the active site of MurT']"	"gatD"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009236', 'name': 'cobalamin biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0004359', 'name': 'glutaminase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0071555', 'name': 'cell wall organization', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A8RBJ7_9FIRM"	"1a40f0f60050d47cbc7301325546e0e62f478d9f"	True	False	False	247	"Lipid II isoglutaminyl synthase (glutamine-hydrolyzing) subunit GatD"	3	""	"MDLKICWLYHDIMDLYGDKGNMLVLRKRCEDRGIQVIIDTLSIGQECDLSSYDILFLGGGADKEQMILISDLLARKDNIQKAMEEGSFVLLICGGYQLFGQYYINAHHEKIEALKFFDYYTDTGENGRRCIGDIAISCDLDGNTYTVVGFENHGGQTKNVNSTLGKVLHGFGNSFEGKQEGFYNGKVLATYMHGPLLPKNPEIADFVIYKGLKKRNPNIRLQDLQPLDDTLELKAKQAMLKRLNILK"	"unreviewed"	"{'taxId': '428127', 'scientificName': 'Amedibacillus dolichus DSM 3991', 'fullName': 'Amedibacillus dolichus DSM 3991'}"