"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8G9R8"	"{'domain_architectures': 17395, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'cdd': 2, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 7}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 17395}"	"['Negatively regulates its own expression and that of the subsequent genes in the proximal part of the division and cell wall (dcw) gene cluster. Acts by binding directly to DNA. May also regulate the expression of genes outside the dcw cluster']"	"mraZ"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"MRAZ_SERP5"	"c69104d98f7b4177b1bdbe65a238838f3816e5cb"	True	False	False	152	"Transcriptional regulator MraZ"	3	""	"MFRGATMVNLDSKGRLAVPTRYRELLNEQSEGQMVCTIDLHQPCLLLYPLPEWEIIEQKLSRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLATTLRQHAGLTKEVMLVGQFNKFELWDEQTWYQQVKDDIDAEQSTQEPLSERLQDLSL"	"reviewed"	"{'taxId': '399741', 'scientificName': 'Serratia proteamaculans (strain 568)', 'fullName': 'Serratia proteamaculans (strain 568)'}"
