"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8A734"	"{'domain_architectures': 2316, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ncbifam': 1, 'hamap': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2316}"	"['Non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA']"	"zapB"	"[{'identifier': 'GO:0043093', 'name': 'FtsZ-dependent cytokinesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0090529', 'name': 'cell septum assembly', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"ZAPB_ECOHS"	"e160fb12f509062d7d9a383a7ef8ace759d1b74d"	True	False	False	81	"Cell division protein ZapB"	3	""	"MTMSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEEV"	"reviewed"	"{'taxId': '331112', 'scientificName': 'Escherichia coli O9:H4 (strain HS)', 'fullName': 'Escherichia coli O9:H4 (strain HS)'}"