"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8A6E7"	"{'domain_architectures': 69582, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 69582}"	"['Associates with aggregated proteins, together with IbpB, to stabilize and protect them from irreversible denaturation and extensive proteolysis during heat shock and oxidative stress. Aggregated proteins bound to the IbpAB complex are more efficiently refolded and reactivated by the ATP-dependent chaperone systems ClpB and DnaK/DnaJ/GrpE. Its activity is ATP-independent']"	"ibpA"	""	"IBPA_ECOHS"	"1a49c7cd006c7b597e6e0f45e18cc046e51a1431"	True	False	137	"Small heat shock protein IbpA"	3	""	"MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYIDLERVIPEAKKPRRIEIN"	"reviewed"	"{'taxId': '331112', 'scientificName': 'Escherichia coli O9:H4 (strain HS)', 'fullName': 'Escherichia coli O9:H4 (strain HS)'}"
