"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7ZUJ8"	"{'domain_architectures': 13988, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'cdd': 1, 'ssf': 1, 'hamap': 1, 'pfam': 2, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 13988}"	"['Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors']"	"rplJ"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015934', 'name': 'large ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL10_ECO24"	"566544af311940aa66ef32ae4418b9a3694a6e12"	True	False	False	165	"Large ribosomal subunit protein uL10"	3	"UP000001122"	"MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA"	"reviewed"	"{'taxId': '331111', 'scientificName': 'Escherichia coli O139:H28 (strain E24377A / ETEC)', 'fullName': 'Escherichia coli O139:H28 (strain E24377A / ETEC)'}"
