"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7Z6U4"	"{'domain_architectures': 85233, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 2, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 85233}"	"[""This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis""]"	"RBAM_023600"	"[{'identifier': 'GO:0004126', 'name': 'cytidine deaminase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A7Z6U4_BACVZ"	"f99539802ad74cdae12e721eaf57a43643662eeb"	True	False	False	136	"Cytidine deaminase"	3	"UP000001120"	"MNRQELIAEALKARDTAYVPYSNFRVGAALLTKDGKVYRGCNIENAAYSMCNCAERTAIFKAVSEGDTEFAMLAVAADTPGPVSPCGACRQVISELCSKDMLVILTNLQGQIKEMTAEELLPGAFSSEDLHDERKL"	"unreviewed"	"{'taxId': '326423', 'scientificName': 'Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)', 'fullName': 'Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)'}"
