"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7Z4M5"	"{'domain_architectures': 70445, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 2, 'ssf': 1, 'cathgene3d': 2, 'profile': 1, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 70445}"	"['Essential protein that is required for a late step of 50S ribosomal subunit assembly. Has GTPase activity that is stimulated by interaction with the immature 50S ribosome subunit. Binds to the 23S rRNA. Required for the association of ribosomal proteins rplP and rpmA with the large subunit', 'Required for a late step of 50S ribosomal subunit assembly. Has GTPase activity']"	"ylqF"	"[{'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A7Z4M5_BACVZ"	"4b93c256160c3eea4f0633720a92f3a06a024d5d"	True	False	False	282	"Ribosome biogenesis GTPase A"	3	"UP000001120"	"MTIQWFPGHMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEEILKNKPRIMLLNKADKADAAVTAQWKDHFQEQGIPSLSINSVNGQGLHQIVPSSKELLKDKFDKMKAKGIRPRAIRALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKFEDELVGLRLAITGAIKDTIINLQDVAVFGLRFLEEHYPDRLKERYGLQEIPEDIAALFDAIGEKRGCLMGGGMVDYDKTTEVIIRDIRTEKFGRLSFETPSE"	"unreviewed"	"{'taxId': '326423', 'scientificName': 'Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)', 'fullName': 'Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)'}"