"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7Z0L3"	"{'domain_architectures': 17724, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 17724}"	"['Involved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP)']"	"ispF"	"[{'identifier': 'GO:0008685', 'name': '2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016114', 'name': 'terpenoid biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"ISPF_BACVZ"	"4806cfc55513dcfafc7c50c91b7c811c37f0503d"	True	False	False	158	"2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"	3	"UP000001120"	"MFRIGQGFDVHQLTEGRPLIIGGIEIPYEKGLLGHSDADVLLHTVADACLGAAGEGDIGKHFPDTDPEFKDADSFKLLQHVWNIVKEKGYVLGNIDCTIIAQKPKMAPHIDAMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKA"	"reviewed"	"{'taxId': '326423', 'scientificName': 'Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)', 'fullName': 'Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)'}"
