"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7Y3I0"	"{'domain_architectures': 19477, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'cdd': 1, 'pfam': 1, 'profile': 1, 'hamap': 1, 'pirsf': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 19477}"	"['Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions']"	"petD"	"[{'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0009767', 'name': 'photosynthetic electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042651', 'name': 'thylakoid membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A7Y3I0_IPOPU"	"35fdfd4f934bf55a6d167a2125a6bd674b082c9f"	True	False	False	160	"Cytochrome b6-f complex subunit 4"	3	""	"MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDQSLTLGLF"	"unreviewed"	"{'taxId': '4121', 'scientificName': 'Ipomoea purpurea', 'fullName': 'Ipomoea purpurea (Common morning glory)'}"