"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7SUW1"	"{'domain_architectures': 22521, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'panther': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22521}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Required for proper complex I assembly. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"NEMVEDRAFT_v1g193830"	"[{'identifier': 'GO:0045271', 'name': 'respiratory chain complex I', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A7SUW1_NEMVE"	"8f2d10ec74c5645583df816b973bc6cd2b0857e5"	True	False	False	125	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6"	3	"UP000001593"	"MAAKQVAQTVGRAVAKPLLSTTPAEARRRVFNLYRAWWREIPHTVQAFALDISVKSGRNKVREEFMKNANVKDLRIIDMLVIKGKMELEETHNIWKQRTHVMRYFKETENQRRSDFLGRFYEGYD"	"unreviewed"	"{'taxId': '45351', 'scientificName': 'Nematostella vectensis', 'fullName': 'Nematostella vectensis (Starlet sea anemone)'}"