"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7RNF9"	"{'domain_architectures': 93161, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'smart': 1, 'ssf': 1, 'profile': 2, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 93161}"	"['Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome. Involved in nucleolar processing of pre-18S ribosomal RNA']"	"NEMVEDRAFT_v1g87666"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A7RNF9_NEMVE"	"35c3a2b802fd9ab75d4e0df5220beffd6dca46af"	True	False	True	338	"U3 small nucleolar RNA-associated protein 18 homolog"	3	"UP000001593"	"DDDDDEILARTGRNLATQSERLPKGLLSIKRVKDANAAKPANVRSTSSLEFHPSAKVLLTAGLNKTLDIFQVDGKENPKLQSVFVNRFPIHNAHFTCDGEQVIMSSRRKYFYVYDMIKGQVTRIPGIRGMHARNLEKFKVSPDGKHLVFLGDNGYMILLSSKTKQWVGNLKMNGSVKDVTFSADGSRMYSTGSDGEVYVWDMTTRSCVHKFVDDGCLTGTALAASKDGKYLACGSDSGIVNIYDDQCLLQSQPRPLKSVTNLVTSVTGTQFNSSSEILAISSRVTKDAFKLVHLPSMTVFSNWPNSKVPLRYVNAFDFSPNSGFLSIGNDRGTAQLYR"	"unreviewed"	"{'taxId': '45351', 'scientificName': 'Nematostella vectensis', 'fullName': 'Nematostella vectensis (Starlet sea anemone)'}"
