"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7LJV3"	"{'domain_architectures': 68447, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 68447}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I']"	""	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006120', 'name': 'mitochondrial electron transport, NADH to ubiquinone', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A7LJV3_LOXCO"	"c066dd8c9053ff8f269252858f5fce0f0fa244db"	True	False	True	173	"NADH-ubiquinone oxidoreductase chain 2"	3	""	"QIRKILAFSSISHLGWMTIIIIYNPKLTLLNFYLYTMMTATVFLTLNSIKVMKLSTLMTMWTKVPSLNAMLLLTLLSLAGLPPLTGFLPKWLIIQELTKQEMIPAATLMSLLSLLSLFFYLRLAYCTTITLPPHTTNHMKQWRTSKSTNIMIAVLTTMSLILLPISPMILSII"	"unreviewed"	"{'taxId': '457566', 'scientificName': 'Loxops coccineus coccineus', 'fullName': 'Loxops coccineus coccineus'}"
