General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7LCN2",
        "id": "A7LCN2_MORNI",
        "source_organism": {
            "taxId": "85232",
            "scientificName": "Morus nigra",
            "fullName": "Morus nigra (Black mulberry)"
        },
        "name": "33 kDa subunit of oxygen evolving system of photosystem II",
        "description": null,
        "length": 265,
        "sequence": "MADQLTGARLTCSLQSDFKDLAQKCVDATKIAGIALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNSPPEFQNTKLMTRLTYTLDEIEGPFEVANDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGELIRH",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0010242",
                "name": "oxygen evolving activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010207",
                "name": "photosystem II assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042549",
                "name": "photosystem II stabilization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009654",
                "name": "photosystem II oxygen evolving complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "ida_accession": "a7f798d0d8fb8b668041b55aad37c095356b45e7",
        "counters": {
            "domain_architectures": 1440,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1440
        }
    }
}