"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7I417"	"{'domain_architectures': 41394, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'pfam': 1, 'profile': 1, 'smart': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 41394}"	"[""Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits""]"	"rsmA"	"[{'identifier': 'GO:0000179', 'name': 'rRNA (adenine-N6,N6-)-dimethyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000154', 'name': 'rRNA modification', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RSMA_CAMHC"	"4b0de80b0859cbff9c9536f8e831ccc961a856e4"	True	False	False	269	"Ribosomal RNA small subunit methyltransferase A"	3	"UP000002407"	"MYIAKKKFGQNFLKDKNALNKIIESIPENAENIVEIGAGLGDLTYELLRKFKVKSYEIDKDLIEFLKSKFACELENRKFELVFGDALKFWKNGLCNKNYFLVANLPYYVATNMILKAIDDELCDGFVAMVQKEVAEKFCAESGDSEFGGISVLADIFGKCEFLFSVPADSFEPAPKVVSAVIRLKKTRKIDDIFENSVQYENFKNFLKICFSSPRKTIMKNLSTKFDKEILQSIFEKLDLTTNLRAHELNFTLFFKIFKNLRIRDERNK"	"reviewed"	"{'taxId': '360107', 'scientificName': 'Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)', 'fullName': 'Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)'}"
