"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7GGW4"	"{'domain_architectures': 192712, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'smart': 1, 'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 192712}"	"['May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process']"	"cheY"	"[{'identifier': 'GO:0000160', 'name': 'phosphorelay signal transduction system', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A7GGW4_CLOBL"	"2b3543d858b8ab91bbdca9e4d43b1a8c5763b553"	True	False	False	119	"Stage 0 sporulation protein A homolog"	4	""	"MAKVLIVDDAAFMRMMIKDILEKNGFEVVGEANNGLKAVELYKKEQPDVVTMDITMPDMDGIEAVKAIREFDAAAKIIMCSAMGQQTMVMDAIKAGAKDFIVKPFQADRVLEAIKKVIG"	"unreviewed"	"{'taxId': '441772', 'scientificName': 'Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)', 'fullName': 'Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)'}"