"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7ANI1"	"{'domain_architectures': 48058, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 48058}"	"['Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain']"	"BBOV_III005520"	"[{'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0020037', 'name': 'heme binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A7ANI1_BABBO"	"190ccab1ff44fe1a3b1be561b80e69bb85fa539b"	True	False	False	115	"Cytochrome c domain-containing protein"	3	"UP000002173"	"MSKPEPNVTVPDGDAQKGAKLFKSKCAQCHTTNKGGATKQGPNLYGLFGRASGSADYAYTDANKSSGIVWSDKHLFVYLVNPKEYIPGTKMIFAGLKKEQDRADIIAYLKEATKK"	"unreviewed"	"{'taxId': '5865', 'scientificName': 'Babesia bovis', 'fullName': 'Babesia bovis'}"
