"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6ZZK4"	"{'domain_architectures': 13350, 'entries': 24, 'isoforms': 0, 'proteomes': 0, 'sets': 4, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 3, 'cathgene3d': 2, 'ssf': 2, 'cdd': 2, 'pfam': 2, 'panther': 1, 'hamap': 1, 'prints': 1, 'prosite': 2, 'interpro': 8}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13350}"	"[""Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structures that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double-stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA""]"	"RAD27"	"[{'identifier': 'GO:0004518', 'name': 'nuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016788', 'name': 'hydrolase activity, acting on ester bonds', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"FEN1_YEAS7"	"65d1dc0c0ec0da2fac076aba8890f2d85fde3ea5"	True	False	382	"Flap endonuclease 1"	3	""	"MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEATTELEKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDTLCYRTPFLLRHLTFSEAKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYCESIRGVGPVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDWPYKQARMLFLDPEVIDGNEINLKWSPPKEKELIEYLCDDKKFSEERVKSGISRLKKGLKSGIQGRLDGFFQVVPKTKEQLAAAAKRAQENKKLNKNKNKVTKGRR"	"reviewed"	"{'taxId': '307796', 'scientificName': 'Saccharomyces cerevisiae (strain YJM789)', 'fullName': ""Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)""}"
