"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6X6C5"	"{'domain_architectures': 894065, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'profile': 1, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 894065}"	"['Part of the binding-protein-dependent transport system for glutamine; probably responsible for the translocation of the substrate across the membrane']"	"Oant_4076"	"[{'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0022857', 'name': 'transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0071705', 'name': 'nitrogen compound transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0043190', 'name': 'ATP-binding cassette (ABC) transporter complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A6X6C5_BRUA4"	"149ba0064877cb2f3007f9b95b1a3d82ad06c810"	True	False	False	218	"ABC transmembrane type-1 domain-containing protein"	3	"UP000002301"	"MDYQWDFSGLWQYRGLFLQGLAYTVGFTIITVLSGIFVGTVFALGRLSGNKIITVPIMTVVEIFRCTPVLVQLVWCYYALPMLIGFEISPAMAAFITLTFYGAAFYAEIIRGGIVSIDAGQWDAGRAIGMRRGQLMGKIILPQALRRMVPPLVNQSVLQLKNTSLLSVLAVPDLLYQGQLVTSATYRPLETYTLIAVLYLAVLFPLTRLAHGLEGRLK"	"unreviewed"	"{'taxId': '439375', 'scientificName': 'Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)', 'fullName': 'Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)'}"
