"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6U7K5"	"{'domain_architectures': 21975, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 21975}"	"['Converts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD']"	"Smed_0779"	"[{'identifier': 'GO:0006777', 'name': 'Mo-molybdopterin cofactor biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A6U7K5_SINMW"	"7f26b4bd64731bfa3b72046b085fc9409bd2447d"	True	False	False	156	"Molybdopterin synthase catalytic subunit"	3	""	"MAPAPVNIRVQRDDFDIAVEIAALCRDRTDIGAVVTFSGLCRDEAGALSALELEHYPGMAEAEIERICQDAVERFGLQAATAIHRFGGMEPGANIVLVIAAAPHRQAAFDGANFIMDFLKTSAPFWKKEHRTDGSAGDWISAKDADDDARDRWARG"	"unreviewed"	"{'taxId': '366394', 'scientificName': 'Sinorhizobium medicae (strain WSM419)', 'fullName': 'Sinorhizobium medicae (strain WSM419)'}"
