"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6TE95"	"{'domain_architectures': 1575, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 1, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 1575}"	"['Required for optimal acid stress protection, which is important for survival of enteric bacteria in the acidic environment of the host stomach. Exhibits a chaperone-like activity at acidic pH by preventing the aggregation of many different periplasmic proteins']"	"hdeB"	"[{'identifier': 'GO:0051082', 'name': 'unfolded protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009268', 'name': 'response to pH', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A6TE95_KLEP7"	"fd4fc2aa63f7a42ff9159e954ff9981f5f21fdb7"	True	False	False	101	"Acid stress chaperone HdeB"	1	""	"MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK"	"unreviewed"	"{'taxId': '272620', 'scientificName': 'Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)', 'fullName': 'Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)'}"