"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A6BIS6"	"{'domain_architectures': 44381, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'cathgene3d': 1, 'smart': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 44381}"	"['One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex']"	"infA"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003743', 'name': 'translation initiation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006413', 'name': 'translational initiation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A6BIS6_9FIRM"	"70f1d1b0829b437c03f5cbd338266a2d7b9aebd0"	True	False	False	72	"Translation initiation factor IF-1"	3	""	"MSKADVIEIEGTVVEKLPNAMFQVELENGHQVLAHISGKLRMNFIKILPGDKVTLELSPYDLSKGRIIWRDK"	"unreviewed"	"{'taxId': '411462', 'scientificName': 'Dorea longicatena DSM 13814', 'fullName': 'Dorea longicatena DSM 13814'}"
