"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A5W847"	"{'domain_architectures': 30231, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 2, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 30231}"	"['Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another']"	"frr"	"[{'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RRF_PSEP1"	"2d958ca5738752922f7c19b7aa2806b876ecf5c1"	True	False	False	185	"Ribosome-recycling factor"	3	""	"MINDIKKDAQERMGKSIEALSRNLAAIRTGRAHPSILDSVKVTAWGSEMPLNQVAAITVEDARTLKIVAHDKNLSAAIEKAILTSDLGLNPSSAGTTIRVPMPALTEETRKGYTKQASGVAEDAKVAVRNVRRDALADLKKLTKDKEISEDEERRAADEIQKLTDKFVAEVDAAFKAKEKDLMAV"	"reviewed"	"{'taxId': '351746', 'scientificName': 'Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)', 'fullName': 'Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)'}"
