"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A5UJN3"	"{'domain_architectures': 43462, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prints': 2, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 43462}"	"[""Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs""]"	"rpl7ae"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL7A_METS3"	"e648c895252343045e836caf4ce7bf2296aeba99"	True	False	False	123	"Large ribosomal subunit protein eL8"	3	"UP000001992"	"MAKAIYVKFDTPEELANQAEEALKTAQDSGKVAKGTNEVTKFIERGDAALVVIAEDVDPAEIVAHIPVLADEKEIPYIYLPTKEQVGGAAGLTVGTASACIVDAGDAEGDVAEIVEKIAELKE"	"reviewed"	"{'taxId': '420247', 'scientificName': 'Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)', 'fullName': 'Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)'}"