General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5PLG0",
        "id": "LYRM7_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "Complex III assembly factor LYRM7",
        "description": [
            "Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity)"
        ],
        "length": 104,
        "sequence": "MGTRLKVLRVFKDLHRTRRDVFRDDNRALTAARVKINEEFKKNKNETSDDNIKEMLKMARAVETILRESVIQAEHVDENKIVLRPRKSLLLENVPYCDAPSKKT",
        "proteome": "UP000000437",
        "gene": "LYRM7",
        "go_terms": [
            {
                "identifier": "GO:0034551",
                "name": "mitochondrial respiratory chain complex III assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8f2d10ec74c5645583df816b973bc6cd2b0857e5",
        "counters": {
            "domain_architectures": 22521,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22521
        }
    }
}