"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A5IVE2"	"{'domain_architectures': 293517, 'entries': 18, 'isoforms': 0, 'proteomes': 0, 'sets': 4, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 3, 'smart': 2, 'ssf': 1, 'profile': 2, 'cdd': 2, 'pfam': 2, 'panther': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 293517}"	"['Member of the two-component regulatory system HssS/HssR involved in intracellular heme homeostasis and tempering of staphylococcal virulence. Phosphorylated HssR binds to a direct repeat sequence within hrtAB promoter and activates the expression of hrtAB, an efflux pump, in response to extracellular heme, hemin, hemoglobin or blood (By similarity)']"	"hssR"	"[{'identifier': 'GO:0000160', 'name': 'phosphorelay signal transduction system', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000976', 'name': 'transcription cis-regulatory region binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"HSSR_STAA9"	"214263e87a1ba73528c547c1c5657a9093191d60"	True	False	False	224	"Heme response regulator HssR"	3	""	"MVQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV"	"reviewed"	"{'taxId': '359786', 'scientificName': 'Staphylococcus aureus (strain JH9)', 'fullName': 'Staphylococcus aureus (strain JH9)'}"