"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A5I7J7"	"{'domain_architectures': 29922, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 29922}"	"[""One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA""]"	"rpsQ"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RS17_CLOBH"	"0548c77ed14ca58555a4eaa8b82806ebc5426a6a"	True	False	False	84	"Small ribosomal subunit protein uS17"	3	"UP000001986"	"MERSNRKTRIGRVVSNKMDKTIVVAVETKVRHPLYGKIMNRTTKFKAHDENNAANINDKVLIMETRPLSKQKRWRLVEVVEKAK"	"reviewed"	"{'taxId': '441771', 'scientificName': 'Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)', 'fullName': 'Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)'}"
