"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A5B6J7"	"{'domain_architectures': 16083, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 16083}"	"['Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism']"	"VITISV_013188"	""	"A5B6J7_VITVI"	"3d4a9bb835893a45d07f9261782f557ffe98e74b"	True	False	False	165	"Dirigent protein"	3	""	"MGKGPVRGRRPCRSLVFYFHDIIYNGKNSKNATAAIVGAPAWGNKTILGGKNHFGDLVVFDDPITLDNNLHSTPVGRAQGFYIYDKKDVFTAWLGFSFVFNSTEHKGSINFAGADPLMNKTRDISVVGGTGDFFMARGIATLTTDAFEGEVYFRLCVDIKLYECW"	"unreviewed"	"{'taxId': '29760', 'scientificName': 'Vitis vinifera', 'fullName': 'Vitis vinifera (Grape)'}"
