"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4TH14"	"{'domain_architectures': 58603, 'entries': 20, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 2, 'ssf': 1, 'cathgene3d': 2, 'profile': 1, 'pfam': 2, 'cdd': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 58603}"	"['One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit', 'With S5 and S12 plays an important role in translational accuracy']"	"rpsD"	"[{'identifier': 'GO:0019843', 'name': 'rRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015935', 'name': 'small ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RS4_YERPP"	"d40e1d453ea50e2d0fcfcaee483cefa3c3915568"	True	False	False	206	"Small ribosomal subunit protein uS4"	3	""	"MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQPPGQHGARKPRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYRMGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAEQREKPTWLEVDAVKMEGVFKRIPERTDLSADINEHLIVELYSK"	"reviewed"	"{'taxId': '386656', 'scientificName': 'Yersinia pestis (strain Pestoides F)', 'fullName': 'Yersinia pestis (strain Pestoides F)'}"
