"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4SZP8"	"{'domain_architectures': 19190, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 19190}"	"['Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation']"	"clpS"	"[{'identifier': 'GO:0006508', 'name': 'proteolysis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030163', 'name': 'protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A4SZP8_POLAQ"	"d52f623440b9fe9a889148966c03893a09b55845"	True	False	False	118	"ATP-dependent Clp protease adapter protein ClpS"	3	"UP000000231"	"MFLMSRKPKNPTTGIPANPYAEDTILLEKQVEQIKAPSMYKVLLLNDDYTPMEFVVMVIQEYFNKDHETATRIMLQVHLVGKGICGVFTRDVAATKVHQVIELSREAGHPLQCTMEEA"	"unreviewed"	"{'taxId': '312153', 'scientificName': 'Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)', 'fullName': 'Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)'}"