"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4QK22"	"{'domain_architectures': 44517, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 44517}"	"['NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient']"	"ndhK"	"[{'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0048038', 'name': 'quinone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NDHK_ARAHI"	"ec2bdf213efa2e994a9300f4d128e854c4d858c2"	True	False	False	225	"NAD(P)H-quinone oxidoreductase subunit K, chloroplastic"	3	""	"MNSIKFPVLDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKIAREIYKDQIRPQQGNRCFTTTHKFFVVRSTHTGNYDQELLYPPSSTSEISTETFFKYKSPVSSHELVN"	"reviewed"	"{'taxId': '78191', 'scientificName': 'Arabis hirsuta', 'fullName': 'Arabis hirsuta (Hairy rock-cress)'}"
