"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4QJQ1"	"{'domain_architectures': 13962, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 13962}"	"['Apoprotein for the two 4Fe-4S centers FA and FB of photosystem I (PSI); essential for photochemical activity. FB is the terminal electron acceptor of PSI, donating electrons to ferredoxin. The C-terminus interacts with PsaA/B/D and helps assemble the protein into the PSI complex. Required for binding of PsaD and PsaE to PSI. PSI is a plastocyanin-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn']"	"psaC"	"[{'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009773', 'name': 'photosynthetic electron transport in photosystem I', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015979', 'name': 'photosynthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009522', 'name': 'photosystem I', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0042651', 'name': 'thylakoid membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PSAC_AETGR"	"50f692799a4aac31f6710e3d85c099934fdbb2f6"	True	False	False	81	"Photosystem I iron-sulfur center"	3	""	"MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY"	"reviewed"	"{'taxId': '72657', 'scientificName': 'Aethionema grandiflorum', 'fullName': 'Aethionema grandiflorum (Persian stone-cress)'}"
