"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4KV82"	"{'domain_architectures': 42874, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 42874}"	"['It is also responsible for the non-negligible production of methylglyoxal a reactive cytotoxic side-product that modifies and can alter proteins, DNA and lipids', 'Triosephosphate isomerase is an extremely efficient metabolic enzyme that catalyzes the interconversion between dihydroxyacetone phosphate (DHAP) and D-glyceraldehyde-3-phosphate (G3P) in glycolysis and gluconeogenesis']"	"TPI"	"[{'identifier': 'GO:0004807', 'name': 'triose-phosphate isomerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A4KV82_PLEYO"	"c3c3e169e7801783a548872d8a2d4b37a5ecd302"	True	False	True	73	"Triosephosphate isomerase"	3	""	"SPAMIKDCGVHWVILGHSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIA"	"unreviewed"	"{'taxId': '8337', 'scientificName': 'Plethodon yonahlossee', 'fullName': 'Plethodon yonahlossee (Yonahlossee salamander)'}"