"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4JBA7"	"{'domain_architectures': 8017, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 8017}"	"['Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase']"	"yacG"	"[{'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A4JBA7_BURVG"	"ef27551cf764ab45c001792b439a9233c230771f"	True	False	False	66	"DNA gyrase inhibitor YacG"	3	""	"MVTVVKCPSCGAEVRWTHENKFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSEEDGGDTRRDV"	"unreviewed"	"{'taxId': '269482', 'scientificName': 'Burkholderia vietnamiensis (strain G4 / LMG 22486)', 'fullName': 'Burkholderia vietnamiensis (strain G4 / LMG 22486)'}"
