"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4JAS6"	"{'domain_architectures': 12998, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 12998}"	"['Part of the MsrPQ system that repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O), using respiratory chain electrons. Thus protects these proteins from oxidative-stress damage caused by reactive species of oxygen and chlorine generated by the host defense mechanisms. MsrPQ is essential for the maintenance of envelope integrity under bleach stress, rescuing a wide series of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, using the quinone pool of the respiratory chain']"	"msrQ"	""	"A4JAS6_BURVG"	"b146733987e3df29591d4c1e917874cd598ab678"	True	False	False	230	"Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ"	3	""	"MHPSTLEPRRASSPPAAAAGVARAGTAARAAPQRWLVPARLLVFAVGLYPLARLVLFGLTDRLGANPIEFITRSTGRWTLVILCATLAVTPLRRMTGVAALLRFRRMIGLFAFFYATLHFATYVWFDKWFDVLAILKDVGKRPFITVGFAAFVLLIPLAATSPRAMARRLGRHWATLHRAIYAIALFGVLHFWWMRAGKHDLAQPKLYAAIVAVLLGWRLFEWSRRRIRA"	"unreviewed"	"{'taxId': '269482', 'scientificName': 'Burkholderia vietnamiensis (strain G4 / LMG 22486)', 'fullName': 'Burkholderia vietnamiensis (strain G4 / LMG 22486)'}"