"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4ITI0"	"{'domain_architectures': 70833, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ncbifam': 4, 'hamap': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 70833}"	"['NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient']"	"nuoK"	"[{'identifier': 'GO:0016651', 'name': 'oxidoreductase activity, acting on NAD(P)H', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042773', 'name': 'ATP synthesis coupled electron transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"NUOK_GEOTN"	"5c384e151efd07be17d94f5774ea581a4dbdd6cf"	True	False	False	101	"NADH-quinone oxidoreductase subunit K"	3	""	"MTLSAYLALALILFCIGLYGALTKRNTVIVLICIELMLNAVNINFVAFAKYGAHPGVHGHVFALFAIAIAAAEAAVGLAALIAFYRNRKTVQVDEANSLKH"	"reviewed"	"{'taxId': '420246', 'scientificName': 'Geobacillus thermodenitrificans (strain NG80-2)', 'fullName': 'Geobacillus thermodenitrificans (strain NG80-2)'}"