"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A4FV98"	"{'domain_architectures': 34527, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 34527}"	"[""Protein-lysine methyltransferase that selectively mono-, di- and trimethylates 'Lys-165' of the translation elongation factors EEF1A1 and EEF1A2 in an aminoacyl-tRNA and GTP-dependent manner. EEF1A1 methylation by EEF1AKMT3 is dynamic as well as inducible by stress conditions, such as ER-stress, and plays a regulatory role on mRNA translation""]"	"EEF1AKMT3"	""	"EFMT3_BOVIN"	"d85bd1bd28376eba4c7f1f123f68489110ca4687"	True	False	False	226	"EEF1A lysine methyltransferase 3"	2	"UP000009136"	"MADSRPDPESEPDSVFPREVGLFADCYSEKSRFCFCGHVLNITENFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLVLEQIQGNVQANVPPGGRAQVRALSWGIDQHVFPGDYDLVLGADIVYLEPTFPLLLGTLRHLCGPHGTIYLASKMREEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHRGPRPA"	"reviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"