"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A3M7P2"	"{'domain_architectures': 25316, 'entries': 20, 'isoforms': 0, 'proteomes': 0, 'sets': 4, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 2, 'cathgene3d': 2, 'ssf': 2, 'smart': 2, 'cdd': 2, 'pfam': 2, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 25316}"	"['Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism']"	"rnc"	"[{'identifier': 'GO:0004525', 'name': 'ribonuclease III activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006396', 'name': 'RNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RNC_ACIBT"	"1d1b93569d189b9d241b69a8f442a66312c2282e"	True	False	False	230	"Ribonuclease 3"	3	""	"MTKHQFKLSDPRLLSRIGYQFKQPELLQLALTHRSVSHKYNYERLEFLGDSLLGMIIANYLYHAYPHENEGRLTRMRATLVRQEALGKIATDLQLSRCLILSTGELKSGGHHRESILADTVEAIIGAIYLDSSDLNLLKDIVLKWYTPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVVDIQGDAPHQHFKVECLVDGLSKIHGEGSSRRFAEQAAAAEILKLLEQ"	"reviewed"	"{'taxId': '400667', 'scientificName': 'Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)', 'fullName': 'Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)'}"
