"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A3DR71"	"{'domain_architectures': 8870, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'pirsf': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 8870}"	"['Binds and inhibits the conjugation of the ubiquitin-like G1P2/ISG15 protein to its target proteins. Since G1P2/ISG15 is an early antiviral protein, NS1 may inhibit the host antiviral response. Prevents EIF2AK2/PKR activation, either by binding double strand RNA or by interacting directly with EIF2AK2/PKR. Also binds poly(A) and U6 snRNA']"	"NS1"	""	"A3DR71_9INFB"	"93d2301ee5fb2d52da650e32be4af5e1c3b1f258"	False	False	False	281	"Non-structural protein 1"	3	""	"MADNMTTTQIEVGPGATNATINFEAGILECYERLSWQRALDYPGQDRLNRLKRKLESRIKTHNKSEPESKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPYCMKSSSNSNCPKYNWTDYPSTPGRCLDDIEEEPEDVDGPTEIVLRDMNNKDARQKIKEEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGTFLKHPNGYKSLSTLHRLNAYDQSGRLVAKLVATDDLTVEDEEDGHRILNSLFERLNEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN"	"unreviewed"	"{'taxId': '416689', 'scientificName': 'Influenza B virus (B/New York/24/1993)', 'fullName': 'Influenza B virus (B/New York/24/1993)'}"
