"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A2ZK73"	"{'domain_architectures': 16083, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 16083}"	"['Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism']"	"OsI_38229"	""	"A2ZK73_ORYSI"	"3d4a9bb835893a45d07f9261782f557ffe98e74b"	True	False	False	196	"Dirigent protein"	3	"UP000007015"	"MGSLCGTMIIILAMLPAILTMADPYCDCDCPQQCEVKLHYYLHQFRAGADHPNRNEEFVTSGGPSGLGAGLIHDWSLTTGLDPNVNIVGRAQGWHIVASQSSPANWYLSQNIVFQDSKYAGSTLQVMGIIEGSEEKVGEWSIMGGTGEFTNARGNIKYRAIKKEDVEWIRELDIQVFYTPNTPSDVQVAKNITKGN"	"unreviewed"	"{'taxId': '39946', 'scientificName': 'Oryza sativa subsp. indica', 'fullName': 'Oryza sativa subsp. indica (Rice)'}"
