GET /api/protein/UniProt/A2RNN6/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2RNN6",
        "id": "RS5_LACLM",
        "source_organism": {
            "taxId": "416870",
            "scientificName": "Lactococcus lactis subsp. cremoris (strain MG1363)",
            "fullName": "Lactococcus lactis subsp. cremoris (strain MG1363)"
        },
        "name": "Small ribosomal subunit protein uS5",
        "description": [
            "Component of the small ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell",
            "With uS4 and uS12 plays an important role in translational accuracy",
            "Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body"
        ],
        "length": 168,
        "sequence": "MAENRRNDREQSEFEERVVSINRVTKVVKGGRRLRFAALVVVGDRNGRVGFGTGKAQEVPEAIRKAIEAAKKNLITVPMVGTTLPHEALGVFGGGKILLKPAVEGAGVAAGGAVRAVLELAGVADVTSKSLGSNTPINVVRATVDGLTQLKRAEEVAALRGKSVSDFA",
        "proteome": "UP000000364",
        "gene": "rpsE",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015935",
                "name": "small ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "ddb47877d1b64f864fa25e376c154e201459d42b",
        "counters": {
            "domain_architectures": 26917,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 1,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26917
        }
    }
}