"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A2BIW0"	"{'domain_architectures': 29049, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 29049}"	"['Flavin prenyltransferase that catalyzes the synthesis of the prenylated FMN cofactor (prenyl-FMN) for 4-hydroxy-3-polyprenylbenzoic acid decarboxylase UbiD. The prenyltransferase is metal-independent and links a dimethylallyl moiety from dimethylallyl monophosphate (DMAP) to the flavin N5 and C6 atoms of FMN']"	"ubiX"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A2BIW0_HYPBU"	"a8d4bade61d095bea50675bf04b899cb1d7578d3"	True	False	False	197	"Flavin prenyltransferase UbiX"	3	"UP000002593"	"MLLRGRRVLVAITGASGVIYGARLVAHLAKRGLLEAVIYTPSALIVAREEGIDLEKFIKGLGVPAYLSTRLDAPYASSSRAPWAMVVAPCSMKTLAALAHGYSDNLVTRAALAVLRLGRKLVLVVRETPLGKAELRNMLLAAENGAIILPAAPAFYTRPRTLSDIVDFVVGKILDVLGIEHSLYQRWRGYSNSSSPK"	"unreviewed"	"{'taxId': '415426', 'scientificName': 'Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)', 'fullName': 'Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)'}"