GET /api/protein/UniProt/A2ANA0/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "A2ANA0",
        "id": "A2ANA0_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Protein transport protein SEC23",
        "description": [
            "Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules for their transport to the Golgi complex"
        ],
        "length": 278,
        "sequence": "MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAILNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTIEYMIQRGARSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQEMLGLTKSAMPVQQARPAQPQEQPFVSSRFLQPIHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLE",
        "proteome": "UP000000589",
        "gene": "Sec23b",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006888",
                "name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030127",
                "name": "COPII vesicle coat",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "ida_accession": "8ce9c41358968c8a6856c91d88566e45e1760a71",
        "counters": {
            "domain_architectures": 678,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 3,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 678
        }
    }
}