"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1YYZ7"	"{'domain_architectures': 47020, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ncbifam': 3, 'panther': 1, 'hamap': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 47020}"	"['Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system']"	"tatA"	"[{'identifier': 'GO:0043953', 'name': 'protein transport by the Tat complex', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015031', 'name': 'protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A1YYZ7_XANOO"	"8e9933fb82f0f1a021a5c55eb56f620d16af2308"	True	False	False	75	"Sec-independent protein translocase protein TatA"	3	""	"MGGFSIWHWLIVLVIVLLVFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGKLGDDSRTAEQAREAQAERDRDAR"	"unreviewed"	"{'taxId': '64187', 'scientificName': 'Xanthomonas oryzae pv. oryzae', 'fullName': 'Xanthomonas oryzae pv. oryzae'}"
