"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1S4X0"	"{'domain_architectures': 234891, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 2, 'hamap': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 234891}"	"['Hydrolyzes the pyrophosphate bond of UDP-2,3-diacylglucosamine to yield 2,3-diacylglucosamine 1-phosphate (lipid X) and UMP by catalyzing the attack of water at the alpha-P atom. Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell']"	"lpxH"	"[{'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016462', 'name': 'pyrophosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009245', 'name': 'lipid A biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"LPXH_SHEAM"	"e949b0a1fe9e51299d6615c55240932f5c7152f8"	True	False	False	238	"UDP-2,3-diacylglucosamine hydrolase"	3	"UP000009175"	"MRTLFIGDLHLSADRPDITSAFRRFLSQSFDDVDALYILGDLFEVWVGDDIAEPFALDIAADIAALSHKLPIYFIHGNRDFLIGKQFAAISKMQLLDEVHQINLYGIPTLLLHGDSLCTLDKGYQRFRWFRNQPWVKWIYSKLSQSKRLSIAANLRAKSKAGNQLKSQYIMDAEPHAVADLLQKHSCRQMIHGHTHRPAIHHESAGTRIVVGDWYSQSSVLEMTAEGPNLQAKPLGGS"	"reviewed"	"{'taxId': '326297', 'scientificName': 'Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)', 'fullName': 'Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)'}"
