"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1L1K4"	"{'domain_architectures': 5971, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5971}"	"['Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity)']"	"Cdc42se2"	"[{'identifier': 'GO:0031267', 'name': 'small GTPase binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0035023', 'name': 'regulation of Rho protein signal transduction', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C42S2_RAT"	"024dc5abd707115cafda2b4230f3bbdf9c0ee9c3"	True	False	False	83	"CDC42 small effector protein 2"	3	"UP000002494"	"MSEFWLCFNCCIAEQPQPRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG"	"reviewed"	"{'taxId': '10116', 'scientificName': 'Rattus norvegicus', 'fullName': 'Rattus norvegicus (Rat)'}"