"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1JQG8"	"{'domain_architectures': 27119, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 27119}"	""	"msrB"	"[{'identifier': 'GO:0033743', 'name': 'peptide-methionine (R)-S-oxide reductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016671', 'name': 'oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006979', 'name': 'response to oxidative stress', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030091', 'name': 'protein repair', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"MSRB_YERE8"	"deb4c5e8efd21b1ddf07e78fdbd67304e03e4fcf"	True	False	137	"Peptide methionine sulfoxide reductase MsrB"	3	""	"MAKELNPTENIEKLTDIQRHVTQLRGTEAPFSGKLLHNKREGVYQCLCCHQPLFISESKFDSGCGWPSFYQPLDAESIRYIDDYSHNMHRVEIRCGHCDAHLGHVFSDGPQPTGERYCVNSASLNFVDDQNGEQIPG"	"reviewed"	"{'taxId': '393305', 'scientificName': 'Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)', 'fullName': 'Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)'}"