"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1CL63"	"{'domain_architectures': 2919, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 2, 'prosite': 1, 'prints': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2919}"	"['Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits']"	"rps0"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015935', 'name': 'small ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RSSA_ASPCL"	"a328e9e4e47b02e404d7154b306c7edeeb2dd053"	True	False	False	298	"Small ribosomal subunit protein uS2"	3	"UP000006701"	"MAPSQLPPMFNPTPQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRPDGVNVINIGKTWEKILLAARIIAAIDNPADICVISARPYGQRAVLKFASHTGATAIAGRFTPGNFTNYITRSFKEPRLIIVTDPRTDAQAIKEASYVNIPVIALCDTDSPTDFVDVAIPTNNKGRHAIGLVWWLLAREVLRLRGTLANRETEWDVVVDLYFYRDPEAEENKEIAEETKVPGAEEIGAGAVESGFAGENWDTQAPGAGVPGSAFAAASAAAATSWEADGGDWAASSAPPAGESWAETQPTEAKW"	"reviewed"	"{'taxId': '344612', 'scientificName': 'Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)', 'fullName': 'Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)'}"
