"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1AL40"	"{'domain_architectures': 21482, 'entries': 21, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 2, 'profile': 1, 'ssf': 1, 'cdd': 1, 'ncbifam': 1, 'sfld': 3, 'panther': 1, 'hamap': 1, 'pirsf': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 21482}"	"['Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. m2A2503 modification seems to play a crucial role in the proofreading step occurring at the peptidyl transferase center and thus would serve to optimize ribosomal fidelity']"	"rlmN"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0030488', 'name': 'tRNA methylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0070475', 'name': 'rRNA base methylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008173', 'name': 'RNA methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RLMN_PELPD"	"c13ed286dda33645f2740866658bbdc34c2d4ac8"	True	False	False	347	"Dual-specificity RNA methyltransferase RlmN"	3	"UP000006732"	"MTEKTDLKNLTLPALEQFLRGQGKERFRATQVFKWIYQHDARSFQEMTNISKDLRAELEAKAYISNLEPEAVEVGGDGTRKYLFGLEDGNSVESVLIPDEGRNTLCISSQVGCAMGCAFCLTGTFRLTRNLTTAEIVNQIMAVRRDVEIRNIVMMGMGEPLHNLDNVIPAIHIMIDGNGLQLSNRRVTVSTCGLAPEMERLGRELPNVNLAVSLNATTDELRDRIMPINRRYPLKELLSACREFPLPGRRKVTFEYVMLGGLNDTLEDAKRLLRLTSDIPNKVNLIPFNEFQGCEFRSPTRAAIDAFHKYLIDRHVTVITRDSRGSDISAACGQLKGKLDAARQPTE"	"reviewed"	"{'taxId': '338966', 'scientificName': 'Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)', 'fullName': 'Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)'}"
