General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1AHF3",
        "id": "TDH_ECOK1",
        "source_organism": {
            "taxId": "405955",
            "scientificName": "Escherichia coli O1:K1 / APEC",
            "fullName": "Escherichia coli O1:K1 / APEC"
        },
        "name": "L-threonine 3-dehydrogenase",
        "description": [
            "Catalyzes the NAD(+)-dependent oxidation of L-threonine to 2-amino-3-ketobutyrate"
        ],
        "length": 341,
        "sequence": "MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMVVGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAAAVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELGMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAALIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSWD",
        "proteome": "UP000008216",
        "gene": "tdh",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008743",
                "name": "L-threonine 3-dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006567",
                "name": "L-threonine catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "6e6b076d581cf5733167d9dad5b9a31c66e6d8d3",
        "counters": {
            "domain_architectures": 253716,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "smart": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 253716
        }
    }
}