"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0PM63"	"{'domain_architectures': 40443, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 40443}"	"[""One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit""]"	"rplC"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL3_MYCUA"	"a08494054ebbd1211fe1504167e3ff441c57a831"	True	False	False	217	"Large ribosomal subunit protein uL3"	3	""	"MARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTPERDGYSAVQLAYGEISPRKVNKPVTGQYTAAGVNPRRHLAELRLDDAEAVTEYEVGQELTAEIFADGSYVDVTGTSKGKGFAGTMKRHGFSGQGASHGAQAVHRRPGSIGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDAEQSVLLIKGAVPGRTGGLVTVRSAIKRGEK"	"reviewed"	"{'taxId': '362242', 'scientificName': 'Mycobacterium ulcerans (strain Agy99)', 'fullName': 'Mycobacterium ulcerans (strain Agy99)'}"
